loading…
Search for a command to run...
loading…
An MCP server that connects AI agents to the PEPTOMA open DeSci peptide research platform, enabling peptide sequence analysis, feed search, and peer-review anno
An MCP server that connects AI agents to the PEPTOMA open DeSci peptide research platform, enabling peptide sequence analysis, feed search, and peer-review annotations.
Official MCP (Model Context Protocol) server for PEPTOMA — connect any AI agent to the open DeSci peptide research platform.
peptoma-mcp runs a local MCP server that exposes PEPTOMA's full research platform as tools to any compatible AI agent — Claude Desktop, Cursor, VS Code, Zed, and any other MCP-compatible client.
Once connected, your AI agent can:
No custom code required. Install, configure, and your agent is connected to the live PEPTOMA platform.
pptm_...) — available to PRO (≥ 2,000 $PEPTM staked) and LAB (≥ 10,000 $PEPTM staked) tier wallets# Run directly with npx (no install needed)
npx peptoma-mcp --api-key pptm_your_key_here
# Or install globally
npm install -g peptoma-mcp
peptoma-mcp --api-key pptm_your_key_here
# Or use environment variable
export PEPTOMA_API_KEY=pptm_your_key_here
npx peptoma-mcp
Add to ~/.claude/claude_desktop_config.json:
{
"mcpServers": {
"peptoma": {
"command": "npx",
"args": ["peptoma-mcp", "--api-key", "pptm_your_key_here"]
}
}
}
Restart Claude Desktop. You will now see PEPTOMA tools available in your conversations.
Add to your Cursor MCP config (.cursor/mcp.json or global config):
{
"mcpServers": {
"peptoma": {
"command": "npx",
"args": ["peptoma-mcp", "--api-key", "pptm_your_key_here"]
}
}
}
Add to .vscode/mcp.json in your project:
{
"servers": {
"peptoma": {
"type": "stdio",
"command": "npx",
"args": ["peptoma-mcp", "--api-key", "pptm_your_key_here"]
}
}
}
Once connected, these tools are available to your AI agent:
analyze_sequenceSubmit a peptide sequence for analysis by the PEPTOMA AI Engine.
Inputs:
| Parameter | Type | Required | Description |
|---|---|---|---|
sequence |
string | Yes | Single-letter amino acid code or FASTA format (3–512 residues) |
depth |
"standard" | "deep" |
No | Analysis depth (default: "standard") |
diseaseTarget |
string | No | Disease or organism context (e.g. "MRSA", "Cancer") |
userId |
string | No | Solana wallet address for on-chain attribution |
notes |
string | No | Research notes |
Returns: Full SequenceAnalysis object with bioactivity score, label, structure, toxicity, MW, hydrophobicity, charge, half-life, confidence, and annotation suggestions.
get_analysisRetrieve a previous analysis by ID.
Inputs: id (number)
search_feedSearch the open PEPTOMA research feed.
Inputs:
| Parameter | Type | Description |
|---|---|---|
disease |
string | Filter by disease target |
minScore |
number | Minimum bioactivity score (0–100) |
sort |
"newest" | "score" | "annotations" | "trending" |
Sort order |
limit |
number | Results per page (default: 20) |
page |
number | Page number (default: 1) |
get_feed_statsPlatform-wide statistics: total analyses, average scores, annotation counts, disease breakdown.
get_trendingTop 10 sequences ranked by community vote count.
list_annotationsList all peer-review annotations for a sequence.
Inputs: sequenceId (number)
create_annotationSubmit a peer-review annotation and earn $PEPTM.
Inputs:
| Parameter | Type | Required | Description |
|---|---|---|---|
sequenceId |
number | Yes | Target sequence ID |
userId |
string | Yes | Your wallet address (for token rewards) |
type |
"confirm" | "challenge" | "extend" | "tag" |
Yes | Annotation type |
content |
string | No | Your scientific reasoning or evidence |
Reward rates: confirm +2, challenge +3, extend +5, tag +2 $PEPTM
vote_annotationUpvote or downvote an annotation.
Inputs: annotationId (number), direction ("up" | "down")
get_token_balanceGet $PEPTM balance and staking info for a user.
Inputs: userId (string — Solana wallet address)
get_leaderboardTop contributors ranked by total $PEPTM earned.
Screening antimicrobial candidates:
You: Screen these sequences for MRSA activity and flag anything above 80 with low toxicity:
KWLRRVWRPQKI, FLPLIGRVLSGIL, GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRK
Agent:
→ analyze_sequence("KWLRRVWRPQKI", disease: "MRSA") → score: 91, toxic: low ✓
→ analyze_sequence("FLPLIGRVLSGIL", disease: "MRSA") → score: 67, toxic: medium ✗
→ analyze_sequence("GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRK", disease: "MRSA") → score: 88, toxic: low ✓
2 candidates passed: #1 and #3. Submitting confirmation annotations...
→ create_annotation(sequenceId: 1, type: "confirm", content: "High AMP score, low toxicity...")
→ create_annotation(sequenceId: 3, type: "confirm", content: "Defensin-class AMP candidate...")
Researching what's in the feed:
You: What are the top cancer peptides on PEPTOMA right now?
Agent:
→ search_feed({ disease: "Cancer", sort: "score", limit: 10 })
Returns ranked list with bioactivity scores, structure types, and annotation counts.
Building a research report:
You: Give me a summary of the PEPTOMA platform activity today
Agent:
→ get_feed_stats() → totalAnalyses: 1,247, recentActivity: 34, avgScore: 71.4
→ get_trending() → top 10 sequences with community vote counts
→ get_leaderboard() → top 5 contributors this period
peptoma-mcp [options]
Options:
--api-key <key> Your PEPTOMA API key (pptm_...)
--base-url <url> Override API base URL (default: https://peptoma.xyz/api)
--help Show help
| Variable | Description |
|---|---|
PEPTOMA_API_KEY |
Your PEPTOMA API key — alternative to --api-key flag |
PEPTOMA_BASE_URL |
Override API base URL |
| Resource | URL |
|---|---|
| Platform | peptoma.xyz |
| Docs | peptoma.xyz/docs |
| npm (SDK) | npmjs.com/package/peptoma-sdk |
| npm (MCP) | npmjs.com/package/peptoma-mcp |
| Token CA | HopMHHPfSV2kWQLghKt6xR1oWbPRLA2UyxnKGoPpump |
MIT © 2026 PEPTOMA Team
Выполни в терминале:
claude mcp add peptoma-mcp -- npx Web content fetching and conversion for efficient LLM usage.
Retrieval from AWS Knowledge Base using Bedrock Agent Runtime.
автор: modelcontextprotocolProvides auto-configuration for setting up an MCP server in Spring Boot applications.
A very streamlined mcp client that supports calling and monitoring stdio/sse/streamableHttp, and can also view request responses through the /logs page. It also
автор: xuzexin-hzНе уверен что выбрать?
Найди свой стек за 60 секунд
Автор?
Embed-бейдж для README
Похожее
Все в категории ai